PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 597aa    MW: 64909 Da    PI: 7.4944
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038615genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.8e-31242299260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  PGSC0003DMP400038615 242 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 299
                           8****************************************.***************85 PP

2WRKY106.51.4e-33417475159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+v+g+++prsYY+CtsagCpv+k+ver+++dpk+v++tYeg+Hnh+
  PGSC0003DMP400038615 417 LDDGYKWRKYGQKVVRGNPNPRSYYKCTSAGCPVRKHVERASHDPKAVITTYEGKHNHD 475
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.0E-26232300IPR003657WRKY domain
PROSITE profilePS5081122.136236300IPR003657WRKY domain
SuperFamilySSF1182902.62E-24238300IPR003657WRKY domain
SMARTSM007743.4E-33241299IPR003657WRKY domain
PfamPF031069.3E-24242298IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37402477IPR003657WRKY domain
SuperFamilySSF1182902.22E-29409477IPR003657WRKY domain
PROSITE profilePS5081138.939412477IPR003657WRKY domain
SMARTSM007747.3E-39417476IPR003657WRKY domain
PfamPF031065.3E-26418475IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MEDSHSQQQQ LHSTSEQQLR DGTTSSGGFR HNAAGSNGGA KYKLMTPAML PISRSACITI  60
PPGLSPSSFL ESPVLLSNIK AEPSPTTGSF SKFQTVQGSG GAAAFLLTRG YASGNTYIER  120
KASCFEYKYA GGSSSTSGSL ATEHVTSTGL NQQQNEPLKE VQDQSHPQLL VPSSLAKHEM  180
ETSKELSLSA PINVDASSKE ESLYEPINVD AMNPRDQSSA SMQGSHADHK DVSSVTSDRS  240
SDDGYNWRKY GQKLVKGSEF PRSYYKCTYP NCEVKKIFER SPEGQITEIV YKGSHDHPKP  300
QLSRRFSPGA LMSIQEDKCE KEACFRGQEV YVEDKLNNNV QTSKTEPSST PVSPQQADTG  360
GLEGAGSQMH GTNDDMDEDD QFAKRRKMDG GMDITPVIKP IREPRVVVQT VSEVDILDDG  420
YKWRKYGQKV VRGNPNPRSY YKCTSAGCPV RKHVERASHD PKAVITTYEG KHNHDVPAAK  480
NNNHEMTGSS PVTGSSRIRA GETNSLSLDL GVGTGYRLDN GNNGQLHTLH HQVQVSRSGM  540
MLVQPAAVAA RYGIVHSGMS RFGAIDNRVQ GPSFETLPLQ PSTQSLQNYG KILLGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37242478878Probable WRKY transcription factor 4
2lex_A2e-37242478878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111290.0AB711129.1 Solanum tuberosum StWRKY17 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015082104.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-148WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM1C0Z40.0M1C0Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000574090.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-146WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]